PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00793_0050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 1042aa    MW: 112877 Da    PI: 10.1831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00793_0050genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.87e-1565105445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      W+teEde+l d+v ++G+  W++Ia +m   +t kqc+ rwq
    kfl00793_0050  65 WSTEEDEQLRDLVGKYGTQKWAAIAGKMA-EKTSKQCRRRWQ 105
                      *****************************.9**********9 PP

2Myb_DNA-binding50.35.7e-16114155144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +g W++eEd ll+++++ +G++ W+ Ia+ ++ gRt++ +k+r+
    kfl00793_0050 114 KGGWSEEEDRLLLEGHRNYGNR-WTEIAKLVP-GRTDNAVKNRY 155
                      688*******************.*********.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.57657107IPR017930Myb domain
SuperFamilySSF466891.87E-2660155IPR009057Homeodomain-like
SMARTSM007174.3E-1161110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-1363108IPR009057Homeodomain-like
CDDcd001674.52E-1265105No hitNo description
PfamPF002491.6E-1265105IPR001005SANT/Myb domain
PROSITE profilePS5129421.239109163IPR017930Myb domain
SMARTSM007171.5E-16113161IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-18113161IPR009057Homeodomain-like
PfamPF002494.7E-15114156IPR001005SANT/Myb domain
CDDcd001676.89E-13117155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1042 aa     Download sequence    Send to blast
MNPRRPASTS LPDTMAYYMY QDTSAKGLQP QLQQFQPAAI QLTVAQVKSA EDAPLGKDGK  60
IPVIWSTEED EQLRDLVGKY GTQKWAAIAG KMAEKTSKQC RRRWQIIMNL IGKKGGWSEE  120
EDRLLLEGHR NYGNRWTEIA KLVPGRTDNA VKNRYCALAK KIAEGDKPGK RKRRKRATIE  180
HKAPEGVVAP YPGAIIVKTK LEPKVTPQEG GAQRIQNGGV KRKGPTAYER QRSSESFAER  240
DGNPFSMHWQ AAGSSGGDNS GRYRPPQSAE QRTQALVAEL FGGGHMSQGM EASEGNFVSE  300
GELPGGAYQR LLFVGDGNDP RGNGHSNERR SSHHSSYYPS EHYGARGEVP DSATWYADEA  360
AHGAYPEYHQ GFHPGGANRS TPPGSARAHK RGRMLTSEEL HQHQQRQNGL HRAASQFNVN  420
ARVIYGTPEG GRPKVASRPP SSKSGSPGGK GSRSYPTQLQ HALASIQRAK AQKTSPGRLA  480
TEQASRVKRK YTKREGGLKI ALPEDALLTR VHKVPRDTEM AVGLLAAEMQ HQPKRTRPSL  540
SIHIPKTSGS NPSSPHEGKQ PGARPLSSTR VGPSRLNPET LHKLAQHGVR PRVPSAMRRT  600
ALAMERGMDS RELARSNAHR QAQSQNDMQE IISWMSTPKS KSYFHQYITP GFEASPTFVG  660
SGISSAPPSL NLTPTSACAP ADAAKGLAWE DRFWGASRRS TAGGHFLADD SDGVLLYTDR  720
NVDPPCFRLS PLAFQHEGSP GLNSPGMIPS LPRSPTVGAL PLPKPSLPKL NTPGNSPMTT  780
PKLLSVFSPM LGAYGLTPRK LFFEPGGYCF DDMANEIGLS PRITELTDEA PDLATSAPID  840
TSFTFPSVSQ GEQSDRVKGY SKRTEEKVKG DGKERFDTRN SDVREGSPAQ GLVSESMPGL  900
LALPEVADEA AEDARQGGDG PAISPGMLTY SGLLSPAIPM STRVKGSPLS RSTLLSLTPR  960
GDALASPGFP DGEDDFFFAF SQNMSPLHSP RFLSPVASPI ARAVLAASPR SPFKAPGATW  1020
RSGITSPISS FLSRTTQPHQ DD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-296516110106B-MYB
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169174KRKRRK
2169175KRKRRKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54161421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-33MYB family protein